PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00005434-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family Whirly
Protein Properties Length: 106aa    MW: 11882.5 Da    PI: 4.1824
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00005434-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly21.63.6e-073163107139
            Whirly 107 vnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                       v l v+  +  ++es+s+P++k+efav++s ++
  PSME_00005434-RA  31 VLLGVNDRIADVDESVSIPITKGEFAVMQSTFN 63 
                       568899***********************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF544471.1E-1630102IPR009044ssDNA-binding transcriptional regulator
Gene3DG3DSA:2.30.31.101.2E-163385IPR009044ssDNA-binding transcriptional regulator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MWFDTDLRFG SVFFCSDGEP ENVLASSPPR VLLGVNDRIA DVDESVSIPI TKGEFAVMQS  60
TFNFILPYLM GWHAYMDFPK PNESGHLTSG GPIIAKRPDL EWDVPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A7e-1433104151220p24: plant transcriptional regulator PBF-2
1l3a_B7e-1433104151220p24: plant transcriptional regulator PBF-2
1l3a_C7e-1433104151220p24: plant transcriptional regulator PBF-2
1l3a_D7e-1433104151220p24: plant transcriptional regulator PBF-2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0835151e-76EF083515.1 Picea sitchensis clone WS02721_C09 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008351051.17e-18PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like
TrEMBLA9NQE84e-38A9NQE8_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.18e-19ssDNA-binding transcriptional regulator